PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.J493700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family B3
Protein Properties Length: 445aa    MW: 50703.9 Da    PI: 9.626
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.J493700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B351.32.1e-16146232392
                        EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
                 B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                        k+    ++++++ l l  +f++ +g+ k++ +tl+    s +sW+v     +k ++y+l++GW  F+k+n+L egD+++F  +++++ + 
  Pavir.J493700.1.p 146 KKQ--INANTLKELALATSFCDVIGLRKPCMITLKTSMISTESWQVCGL-PRKNKSYMLRQGWTTFCKENNLMEGDICTFNIIETTSWHV 232
                        444..344555669*******999****99988888889*******994.555568*************************887655444 PP

2B339.31.2e-12349433186
                        EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEE.TTS...-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                 B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltled.esg...rsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                        ++k++++ ++ +++ ++lp ++ + +g+ k++   +tl++ +s+    sW v l +  + ++ ++++GWk F+ +n++++gD+++Fk ++
  Pavir.J493700.1.p 349 WIKKEMNDSTIERQ-FCLPLSC-KVIGLRKPCM--ITLKTsPSStstSSWLVSL-HPYQNCSQLIGSGWKTFCYENKIRVGDVCTFKIVE 433
                        67888888888876.9999985.6889998885..555553444677*******.444445579***********************765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086310.179182IPR003340B3 DNA binding domain
SuperFamilySSF1019363.34E-10184IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.6E-10384IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.1E-17139234IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.1E-16139235IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.475142238IPR003340B3 DNA binding domain
PfamPF023621.2E-12149234IPR003340B3 DNA binding domain
CDDcd100171.96E-9150229No hitNo description
CDDcd100173.18E-7350435No hitNo description
PfamPF023621.1E-9352434IPR003340B3 DNA binding domain
SuperFamilySSF1019365.89E-12352443IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.5E-12352443IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.024380444IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 445 aa     Download sequence    Send to blast
MLIPAQIRQH CIPENLNSCM TIVLRPPGKI AQIELKMDDQ SDLFLTGGWS QFLASHGITD  60
ANALLLKYEG NMVWTVKVFE HDGCQRGSRN KDIRMQQDME EQPSSACTHR CCRDREKKPK  120
GPMTRLNKAT LLMKSVYEIG PPSWIKKQIN ANTLKELALA TSFCDVIGLR KPCMITLKTS  180
MISTESWQVC GLPRKNKSYM LRQGWTTFCK ENNLMEGDIC TFNIIETTSW HVIITWYKEE  240
MINQLFCESV SASKRKSEND RSSSEEKMRL KCSMTSLNKA SSKTSAFEMG PPAWIKGING  300
SSIQKQFKRK SKSQRSSNKE QKRRKSYKTS LNKESTMTKC VFEIGPSAWI KKEMNDSTIE  360
RQFCLPLSCK VIGLRKPCMI TLKTSPSSTS TSSWLVSLHP YQNCSQLIGS GWKTFCYENK  420
IRVGDVCTFK IVETTQWDVI IECR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1307324KRKSKSQRSSNKEQKRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0A9S1931e-127A0A0A9S193_ARUDO; Uncharacterized protein
STRINGSi010026m1e-77(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42535187
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17010.11e-09B3 family protein